(data stored in ACNUC1104 zone)

EMBL: BX640427.PE56

BX640427.PE56        Location/Qualifiers
FT   CDS             54163..54771
FT                   /transl_table=11
FT                   /locus_tag="BPP1347"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2131"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="PDB:1ZBO"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAM7"
FT                   /protein_id="CAE36649.1"
FT                   /translation="MAEIPLFPLSNALFPAGVLRLRVFEIRYLDMVRRCIADGSEFGVV
FT                   VLEQGTEVRRPDGREVLARAGTMARIDHWEAPMPALLELACTGTGRFRLHACTQGKYGL
FT                   WTGQAEPVPDDAPLEVPPELARSASALGRLIARLQREGVPPHIMPMAAPFRLDDCGWVA
FT                   DRWAEMLSLPPADKARLLLLPPLDRLREIDAVLAADGHA"
     MAEIPLFPLS NALFPAGVLR LRVFEIRYLD MVRRCIADGS EFGVVVLEQG TEVRRPDGRE        60
     VLARAGTMAR IDHWEAPMPA LLELACTGTG RFRLHACTQG KYGLWTGQAE PVPDDAPLEV       120
     PPELARSASA LGRLIARLQR EGVPPHIMPM AAPFRLDDCG WVADRWAEML SLPPADKARL       180
     LLLPPLDRLR EIDAVLAADG HA                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page