(data stored in ACNUC1104 zone)

EMBL: BX640427.PE59

BX640427.PE59        Location/Qualifiers
FT   CDS             complement(56557..57618)
FT                   /transl_table=11
FT                   /locus_tag="BPP1350"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2128"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAM4"
FT                   /protein_id="CAE36652.1"
FT                   /translation="MRSIAMQAADLYVLQTAQSWLDAGQAAVLLTVARTWGSSPRPPGA
FT                   MMAIRADGAVAGSVSGGCIEDDLIDQIRQRGIAALCPGARPALATYGVDGEQARRFGLP
FT                   CGGTLQLVLEPLGAHSRLADLLARLRAHQTVRRSVRLADGAVTLEPAAADAEPRLDGAG
FT                   FASVLGPRHRLLVVGAGQLSRYLCEMAIALDFDVTVSDPRQEYRAGWQVEGVALTTAMP
FT                   DDMVIAARPDARTAVIALTHDPKLDDLALIDALQTPAFYVGALGSRANHARRVARLREH
FT                   FGLTPAQLARLRGPAGIYIGSRTPPEIALSIMAEIVAGKNGAPLPPAASVAAGKARQPG
FT                   GAGVIQAGLCATL"
     MRSIAMQAAD LYVLQTAQSW LDAGQAAVLL TVARTWGSSP RPPGAMMAIR ADGAVAGSVS        60
     GGCIEDDLID QIRQRGIAAL CPGARPALAT YGVDGEQARR FGLPCGGTLQ LVLEPLGAHS       120
     RLADLLARLR AHQTVRRSVR LADGAVTLEP AAADAEPRLD GAGFASVLGP RHRLLVVGAG       180
     QLSRYLCEMA IALDFDVTVS DPRQEYRAGW QVEGVALTTA MPDDMVIAAR PDARTAVIAL       240
     THDPKLDDLA LIDALQTPAF YVGALGSRAN HARRVARLRE HFGLTPAQLA RLRGPAGIYI       300
     GSRTPPEIAL SIMAEIVAGK NGAPLPPAAS VAAGKARQPG GAGVIQAGLC ATL              353
//

If you have problems or comments...

PBIL Back to PBIL home page