(data stored in ACNUC1104 zone)

EMBL: BX640427.PE6

BX640427.PE6         Location/Qualifiers
FT   CDS             4885..5844
FT                   /transl_table=11
FT                   /locus_tag="BPP1297"
FT                   /product="ABC transport protein inner membrane component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2593"
FT                   /db_xref="GOA:Q7WAS1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAS1"
FT                   /protein_id="CAE36599.1"
FT                   /translation="MWAYLVRRLGHVVFVVAAMAVLIFLITQAMPGNVAYTIAGHFASP
FT                   EQVAAIEARLGLNDPLWTQFWRWAGAALHGDMGQSLVMGRPVGPLISAALGRSALLAVA
FT                   ALVLTAALGIFLGVVAAVRHGRWQDRLILAFSWLSISLPQFLIAIVLVLLVAGTLGWLP
FT                   ATGYVELSAGFGAWLSHLVMPVCTLVLGLVAHVTSLQRSSMLETLSAPYVRAARAKGLR
FT                   ERTVLYRHALRNALIPTVTVLALDFGILMGGIVVVETVFSYPGLGRLLIFAVEQKDLPV
FT                   LQAGVLAVTVIYALANLAADIAYAILDPRIRYGNLDTH"
     MWAYLVRRLG HVVFVVAAMA VLIFLITQAM PGNVAYTIAG HFASPEQVAA IEARLGLNDP        60
     LWTQFWRWAG AALHGDMGQS LVMGRPVGPL ISAALGRSAL LAVAALVLTA ALGIFLGVVA       120
     AVRHGRWQDR LILAFSWLSI SLPQFLIAIV LVLLVAGTLG WLPATGYVEL SAGFGAWLSH       180
     LVMPVCTLVL GLVAHVTSLQ RSSMLETLSA PYVRAARAKG LRERTVLYRH ALRNALIPTV       240
     TVLALDFGIL MGGIVVVETV FSYPGLGRLL IFAVEQKDLP VLQAGVLAVT VIYALANLAA       300
     DIAYAILDPR IRYGNLDTH                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page