(data stored in ACNUC1104 zone)

EMBL: BX640427.PE62

BX640427.PE62        Location/Qualifiers
FT   CDS             complement(60458..60802)
FT                   /transl_table=11
FT                   /locus_tag="BPP1353"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2125A"
FT                   /db_xref="InterPro:IPR021719"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAM2"
FT                   /protein_id="CAE36655.1"
FT                   /translation="MIWKLIPIALLADLTACASGTRTDSSPPASSQTSSSAAPGSATTP
FT                   SGPDCDAQPVQNLVGQKYSDSVGNDALRRSNSGSMRLLKPGQVMTMEYNAHRLNIILEG
FT                   NGSISALRCG"
     MIWKLIPIAL LADLTACASG TRTDSSPPAS SQTSSSAAPG SATTPSGPDC DAQPVQNLVG        60
     QKYSDSVGND ALRRSNSGSM RLLKPGQVMT MEYNAHRLNI ILEGNGSISA LRCG             114
//

If you have problems or comments...

PBIL Back to PBIL home page