(data stored in ACNUC1104 zone)

EMBL: BX640427.PE64

BX640427.PE64        Location/Qualifiers
FT   CDS             61915..62964
FT                   /transl_table=11
FT                   /locus_tag="BPP1355"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2124"
FT                   /db_xref="GOA:Q7WAM0"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAM0"
FT                   /protein_id="CAE36657.1"
FT                   /translation="MRRRRAGRAAGIMAVVRYDIPGALMSDSLVFHTDLPGLADGPWHG
FT                   GELAMQERAGARERMAQLGPRVIRDYMPQQHRDFFAQLPFMLLATVDAQGDPWASVLEG
FT                   PPGFAHSPDERTLRLDAWPAGDDPARAGLAHGAGVGMLGIELSTRRRNRVNGHVAALDG
FT                   QGFCVVVTQSFGNCPQYIQTRHARQAAPAPQPARWLAGLDAAARTLVGQADTLFVASYA
FT                   RQAGPHAVDVSHRGGPPGFVHLRGDTLTMPDFSGNRFFNTLGNLLANPRAGLVFVDFAR
FT                   GDLLQLCGRAEVLAEAGAPAAYPGAQRLWRVHVERAVRRPAALGLRAGFGEYAAQLAAV
FT                   GQWAGEPPA"
     MRRRRAGRAA GIMAVVRYDI PGALMSDSLV FHTDLPGLAD GPWHGGELAM QERAGARERM        60
     AQLGPRVIRD YMPQQHRDFF AQLPFMLLAT VDAQGDPWAS VLEGPPGFAH SPDERTLRLD       120
     AWPAGDDPAR AGLAHGAGVG MLGIELSTRR RNRVNGHVAA LDGQGFCVVV TQSFGNCPQY       180
     IQTRHARQAA PAPQPARWLA GLDAAARTLV GQADTLFVAS YARQAGPHAV DVSHRGGPPG       240
     FVHLRGDTLT MPDFSGNRFF NTLGNLLANP RAGLVFVDFA RGDLLQLCGR AEVLAEAGAP       300
     AAYPGAQRLW RVHVERAVRR PAALGLRAGF GEYAAQLAAV GQWAGEPPA                   349
//

If you have problems or comments...

PBIL Back to PBIL home page