(data stored in ACNUC1104 zone)

EMBL: BX640427.PE72

BX640427.PE72        Location/Qualifiers
FT   CDS             69588..70298
FT                   /transl_table=11
FT                   /locus_tag="BPP1363"
FT                   /product="putative GNAT-family acetyltransferase"
FT                   /note="Similar to Brucella melitensis
FT                   ribosomal-protein-serine acetyltransferase Bmeii0002
FT                   SWALL:Q8YE16 (EMBL:AE009639) (242 aa) fasta scores: E():
FT                   1.2e-49, 58.9% id in 219 aa, and to Rhizobium loti
FT                   hypothetical protein Mll2986 SWALL:Q98H84 (EMBL:AP003000)
FT                   (228 aa) fasta scores: E(): 4.3e-49, 56.05% id in 223 aa"
FT                   /db_xref="GOA:Q7WAL3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAL3"
FT                   /protein_id="CAE36665.1"
FT                   /translation="MSARVNEFGQPIGQAMPQWQARPRPPRDPAEGRYCRLEPLDAARH
FT                   GDDLYAAFAVPDAASGWTYLSAGPFADRAGYDEYLRKAADSADPLHHAVIDLASGRAIG
FT                   TLSLMRIDPANGVIEVGHVNFAPALRRSPASTEAQYLLMRRAFDELGYRRYEWKCDSLN
FT                   APSRAAALRLGFLFEGIFRQALVYKGRTRDTAWFSIIDSEWPALRAAFERWLAPENFDA
FT                   AGRQRKRLDACRQP"
     MSARVNEFGQ PIGQAMPQWQ ARPRPPRDPA EGRYCRLEPL DAARHGDDLY AAFAVPDAAS        60
     GWTYLSAGPF ADRAGYDEYL RKAADSADPL HHAVIDLASG RAIGTLSLMR IDPANGVIEV       120
     GHVNFAPALR RSPASTEAQY LLMRRAFDEL GYRRYEWKCD SLNAPSRAAA LRLGFLFEGI       180
     FRQALVYKGR TRDTAWFSII DSEWPALRAA FERWLAPENF DAAGRQRKRL DACRQP           236
//

If you have problems or comments...

PBIL Back to PBIL home page