(data stored in ACNUC1104 zone)

EMBL: BX640427.PE73

BX640427.PE73        Location/Qualifiers
FT   CDS             complement(70401..71327)
FT                   /transl_table=11
FT                   /locus_tag="BPP1364"
FT                   /product="integral membrane protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa1411 SWALL:Q9I3T3 (EMBL:AE004570) (303 aa) fasta
FT                   scores: E(): 3.7e-60, 59.67% id in 305 aa, and to Ralstonia
FT                   solanacearum hypothetical transmembrane protein Rsc0519 or
FT                   Rs04969 SWALL:Q8Y218 (EMBL:AL646059) (301 aa) fasta scores:
FT                   E(): 7.5e-54, 55.44% id in 303 aa"
FT                   /db_xref="GOA:Q7WAL2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAL2"
FT                   /protein_id="CAE36666.1"
FT                   /translation="MAAAAPLRRPLDGFATYVMLALCICWGFQQIAIKLVAADVSPTLQ
FT                   IGLRSAFAAVVLIWVVLRHEGLGALRDGTLGPGLAVGALFALEFLLVGVGLEYTTASHM
FT                   AVFLYTAPIFTALGLHLLLPDERLKPLQWLGVAVAFGGIATAFLGKGHAAVPGMLLGDL
FT                   LGVLAGAAWGATTVAIRKSSLSEAAPAKTLFYQMLMAGLALPAFHFASGGAAPVWSGAA
FT                   LASLGFQSVVVALSSYLAWFWLLRRYLATRLAVLSFMTPLFGVTFGVLILDEPLDSGFV
FT                   IGAVLVLAGITLVSGAELLREKLRRRT"
     MAAAAPLRRP LDGFATYVML ALCICWGFQQ IAIKLVAADV SPTLQIGLRS AFAAVVLIWV        60
     VLRHEGLGAL RDGTLGPGLA VGALFALEFL LVGVGLEYTT ASHMAVFLYT APIFTALGLH       120
     LLLPDERLKP LQWLGVAVAF GGIATAFLGK GHAAVPGMLL GDLLGVLAGA AWGATTVAIR       180
     KSSLSEAAPA KTLFYQMLMA GLALPAFHFA SGGAAPVWSG AALASLGFQS VVVALSSYLA       240
     WFWLLRRYLA TRLAVLSFMT PLFGVTFGVL ILDEPLDSGF VIGAVLVLAG ITLVSGAELL       300
     REKLRRRT                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page