(data stored in ACNUC1104 zone)

EMBL: BX640427.PE74

BX640427.PE74        Location/Qualifiers
FT   CDS             complement(71330..71665)
FT                   /transl_table=11
FT                   /locus_tag="BPP1365"
FT                   /product="putative thioredoxin"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa1751 SWALL:Q9I2Y6 (EMBL:AE004601) (125 aa) fasta
FT                   scores: E(): 3.1e-21, 53.7% id in 108 aa, and to
FT                   Lactococcus lactis thioredoxin TrxA or Ll1644 SWALL:Q9CF37
FT                   (EMBL:AE006395) (104 aa) fasta scores: E(): 0.4, 26.82% id
FT                   in 82 aa"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAL1"
FT                   /protein_id="CAE36667.1"
FT                   /translation="MDQIELTDGTADRYLLDAPGLSLLVFHSRTCATCGVARQRLPEFD
FT                   LPVDRLCWIDAGENGGLVQRYEVFHLPALFVTRDGAYYGPVSAQLADWDLRQQISLALD
FT                   SYPAELP"
     MDQIELTDGT ADRYLLDAPG LSLLVFHSRT CATCGVARQR LPEFDLPVDR LCWIDAGENG        60
     GLVQRYEVFH LPALFVTRDG AYYGPVSAQL ADWDLRQQIS LALDSYPAEL P                111
//

If you have problems or comments...

PBIL Back to PBIL home page