(data stored in ACNUC1104 zone)

EMBL: BX640427.PE78

BX640427.PE78        Location/Qualifiers
FT   CDS             76502..77125
FT                   /transl_table=11
FT                   /locus_tag="BPP1369"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Caulobacter crescentus hypothetical
FT                   protein Cc1925 SWALL:Q9A701 (EMBL:AE005866) (209 aa) fasta
FT                   scores: E(): 2.3e-10, 34.5% id in 200 aa, and to Vibrio
FT                   cholerae tellurite resistance protein-related protein
FT                   Vc0813 SWALL:Q9KTS5 (EMBL:AE004166) (192 aa) fasta scores:
FT                   E(): 2e-09, 29.38% id in 194 aa"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAK7"
FT                   /protein_id="CAE36671.1"
FT                   /translation="MTLTSDDLRQIAALTLAHYDDNAVSFEVGTRDHDVSQNIAALLRH
FT                   IQGDPPYAILDFGCGPGRDLKTFAALGHAAVGLDGAAHFVAMAHQATGCEVWQQDFLRL
FT                   ALPAGRFDGIFANASLFHVPTQELPRVLGELRDTLKPGGVLFCSNPRGGNEEGWSRGRY
FT                   GVWHDWESWRALLEAAGFQALEHYYRPAGLPREQQQWLASVWRR"
     MTLTSDDLRQ IAALTLAHYD DNAVSFEVGT RDHDVSQNIA ALLRHIQGDP PYAILDFGCG        60
     PGRDLKTFAA LGHAAVGLDG AAHFVAMAHQ ATGCEVWQQD FLRLALPAGR FDGIFANASL       120
     FHVPTQELPR VLGELRDTLK PGGVLFCSNP RGGNEEGWSR GRYGVWHDWE SWRALLEAAG       180
     FQALEHYYRP AGLPREQQQW LASVWRR                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page