(data stored in ACNUC1104 zone)

EMBL: BX640427.PE79

BX640427.PE79        Location/Qualifiers
FT   CDS             77113..77646
FT                   /transl_table=11
FT                   /locus_tag="BPP1370"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Ralstonia solanacearum hypothetical
FT                   protein Rsc0991 or Rs04301 SWALL:Q8Y0Q2 (EMBL:AL646062)
FT                   (166 aa) fasta scores: E(): 2.3e-21, 48.14% id in 162 aa,
FT                   and to Caulobacter crescentus hypothetical protein Cc2489
FT                   SWALL:Q9A5G1 (EMBL:AE005918) (191 aa) fasta scores: E():
FT                   5.4e-18, 43.45% id in 168 aa"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR026353"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAK6"
FT                   /protein_id="CAE36672.1"
FT                   /translation="MAQVAGFAALARADARVLVLGSMPGVASLRAQQYYGHPRNAFWPI
FT                   AAELFGLDAAQPYAHRVQALQRAGVALWDVLQACERPGSLDAAIVADSVRPNDFQAFFA
FT                   SHPGIACVGLNGAAAATLYRRHVLPRLHGLAHLRYVALPSTSPAHAAMDFAAKLRAWRA
FT                   IAPASSDPSACLSP"
     MAQVAGFAAL ARADARVLVL GSMPGVASLR AQQYYGHPRN AFWPIAAELF GLDAAQPYAH        60
     RVQALQRAGV ALWDVLQACE RPGSLDAAIV ADSVRPNDFQ AFFASHPGIA CVGLNGAAAA       120
     TLYRRHVLPR LHGLAHLRYV ALPSTSPAHA AMDFAAKLRA WRAIAPASSD PSACLSP          177
//

If you have problems or comments...

PBIL Back to PBIL home page