(data stored in ACNUC1104 zone)

EMBL: BX640427.PE81

BX640427.PE81        Location/Qualifiers
FT   CDS             complement(78656..79618)
FT                   /transl_table=11
FT                   /locus_tag="BPP1372"
FT                   /product="probable 3-hydroxybutyryl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /note="Similar to Escherichia coli probable
FT                   3-hydroxybutyryl-CoA dehydrogenase PaaH or B1395
FT                   SWALL:PAAH_ECOLI (SWALL:P76083) (475 aa) fasta scores: E():
FT                   6.4e-20, 35.21% id in 284 aa, and to Mycobacterium
FT                   tuberculosis putative 3-hydroxybutyryl-CoA dehydrogenase
FT                   FadB3 or Rv1715 or Mtv048.02 or Mt1754 SWALL:O53928
FT                   (EMBL:AL022003) (304 aa) fasta scores: E(): 2.3e-29, 38% id
FT                   in 300 aa"
FT                   /db_xref="GOA:Q7WAK4"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAK4"
FT                   /protein_id="CAE36674.1"
FT                   /translation="MSSPDSALGRPGASHAVVIGGGTMGADVAVVLARALCRTTVVEPD
FT                   AARAAALPRRAADNLAQAGRAEGAAHIAVVPGLDAVEWDSVGLVIECVPERLDIKQALF
FT                   AELARRAPAHAILASNSSSFPISAIGAGLPTRERMLGLHFFMPAHLVPLVEVVLCEASD
FT                   PACADVLIAFMRRCGMVPVRVAQDLPGFLANRLQHALSREAFDLIDRGIASPEDVDAAV
FT                   RFGFGFRFLAAGPVMQRDHAGIDVHAAAGATMYPTFCNADTPARCLTERAADGRHGMKA
FT                   GTGFYAWTPETIAAERARYDRLLRAGLDLLGAELPEIQP"
     MSSPDSALGR PGASHAVVIG GGTMGADVAV VLARALCRTT VVEPDAARAA ALPRRAADNL        60
     AQAGRAEGAA HIAVVPGLDA VEWDSVGLVI ECVPERLDIK QALFAELARR APAHAILASN       120
     SSSFPISAIG AGLPTRERML GLHFFMPAHL VPLVEVVLCE ASDPACADVL IAFMRRCGMV       180
     PVRVAQDLPG FLANRLQHAL SREAFDLIDR GIASPEDVDA AVRFGFGFRF LAAGPVMQRD       240
     HAGIDVHAAA GATMYPTFCN ADTPARCLTE RAADGRHGMK AGTGFYAWTP ETIAAERARY       300
     DRLLRAGLDL LGAELPEIQP                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page