(data stored in ACNUC1104 zone)

EMBL: BX640427.PE83

BX640427.PE83        Location/Qualifiers
FT   CDS             complement(80658..81950)
FT                   /transl_table=11
FT                   /locus_tag="BPP1374"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Agrobacterium tumefaciens putative
FT                   transmembrane protein DctM SWALL:Q9F7C8 (EMBL:AF282677)
FT                   (416 aa) fasta scores: E(): 4.9e-61, 43.9% id in 410 aa,
FT                   and to Pasteurella multocida hypothetical protein Pm1527
FT                   SWALL:Q9CKS9 (EMBL:AE006189) (442 aa) fasta scores: E():
FT                   1.2e-58, 39.11% id in 427 aa"
FT                   /db_xref="GOA:Q7WAK2"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAK2"
FT                   /protein_id="CAE36676.1"
FT                   /translation="MIESLSALGAMLALVFMRVPVAFAMALVGFVGLGLLRGWPPAYAM
FT                   AGSVIYESGFQYLLSVLPLFILMGNFVTESRMSRELYAAAHALLGHRRGGLAMSTIAAC
FT                   GGFGAICGSSLATAATMAKVAYPEMRRMGYSEKLAAGSIAAGGTLGVLIPPSIIMVVYC
FT                   LLTEQSIGKMFAAGVLPGVLAILCYMAAVAWVVRRDPAAGPRGPRSTWPHTLHALRQVW
FT                   MVLALIGMLLGGIYGGLFTPAEAAGVGAFLSFLFACSRRAMTWRRFLDVVVESAKTTGM
FT                   IFVVMIGALMLANFINFTSLPQDLLDVVARHQLSPLTVILAICVIYIVLGCVLESMSMI
FT                   LLTVPVFYPLVQSLGFDLIWFGVIVVVVTEISFITPPFGMNVFVLRGLLPGVSTPTIFR
FT                   GVMPFVVSDVVRLAILVLFPSISLLLPSYVR"
     MIESLSALGA MLALVFMRVP VAFAMALVGF VGLGLLRGWP PAYAMAGSVI YESGFQYLLS        60
     VLPLFILMGN FVTESRMSRE LYAAAHALLG HRRGGLAMST IAACGGFGAI CGSSLATAAT       120
     MAKVAYPEMR RMGYSEKLAA GSIAAGGTLG VLIPPSIIMV VYCLLTEQSI GKMFAAGVLP       180
     GVLAILCYMA AVAWVVRRDP AAGPRGPRST WPHTLHALRQ VWMVLALIGM LLGGIYGGLF       240
     TPAEAAGVGA FLSFLFACSR RAMTWRRFLD VVVESAKTTG MIFVVMIGAL MLANFINFTS       300
     LPQDLLDVVA RHQLSPLTVI LAICVIYIVL GCVLESMSMI LLTVPVFYPL VQSLGFDLIW       360
     FGVIVVVVTE ISFITPPFGM NVFVLRGLLP GVSTPTIFRG VMPFVVSDVV RLAILVLFPS       420
     ISLLLPSYVR                                                              430
//

If you have problems or comments...

PBIL Back to PBIL home page