(data stored in ACNUC1104 zone)

EMBL: BX640427.PE84

BX640427.PE84        Location/Qualifiers
FT   CDS             complement(81943..82434)
FT                   /transl_table=11
FT                   /locus_tag="BPP1375"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   Rb0359 or Smb20373 SWALL:Q92WI0 (EMBL:AL603643) (155 aa)
FT                   fasta scores: E(): 0.0014, 24.34% id in 152 aa, and to
FT                   Escherichia coli hypothetical protein YiaM or B3577
FT                   SWALL:YIAM_ECOLI (SWALL:P37674) (157 aa) fasta scores: E():
FT                   0.0014, 25.8% id in 155 aa"
FT                   /db_xref="GOA:Q7WAK1"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAK1"
FT                   /protein_id="CAE36677.1"
FT                   /translation="MRILDRAVTALLRAIVVISLCGMSLLTVADATGRYLLNRPIMGTV
FT                   EMVELLMVAVIFASIPLVTRARGHITVDSFSHLFSPATLRAQDCVAGLLALTVSACLAW
FT                   VALRKAQSTADYGDMTPMLNIPLAPFVYAMAVLLALDAAYRLAALVGPAATQPEPTQDD
FT                   "
     MRILDRAVTA LLRAIVVISL CGMSLLTVAD ATGRYLLNRP IMGTVEMVEL LMVAVIFASI        60
     PLVTRARGHI TVDSFSHLFS PATLRAQDCV AGLLALTVSA CLAWVALRKA QSTADYGDMT       120
     PMLNIPLAPF VYAMAVLLAL DAAYRLAALV GPAATQPEPT QDD                         163
//

If you have problems or comments...

PBIL Back to PBIL home page