(data stored in ACNUC1104 zone)

EMBL: BX640427.PE85

BX640427.PE85        Location/Qualifiers
FT   CDS             complement(82444..83475)
FT                   /transl_table=11
FT                   /locus_tag="BPP1376"
FT                   /product="putative extracellular solute-binding protein"
FT                   /note="Similar to Agrobacterium tumefaciens putative
FT                   periplasmatic membrane protein DctP SWALL:Q9F7C9
FT                   (EMBL:AF282677) (330 aa) fasta scores: E(): 4.2e-20, 27.19%
FT                   id in 342 aa, and to Pasteurella multocida DctP or Pm1525
FT                   SWALL:Q9CKT1 (EMBL:AE006189) (340 aa) fasta scores: E():
FT                   4.5e-21, 28.78% id in 337 aa"
FT                   /db_xref="GOA:Q7WAK0"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAK0"
FT                   /protein_id="CAE36678.1"
FT                   /translation="MMHKTLAAALFALGLAGTAPAIAQKPVELTLSSWLPPTHAVVADF
FT                   LMPWGEEIRKATDGRVTLRLLPKAVTNPAGHFDAVRDGLVDVTFVSHAYYPGRFQLTKF
FT                   AVLPFSGDTATSRSIAAWDTYEKYLLKADEHKGVRLLGIYAHGPGIAFTTSKPVKQIGD
FT                   FQGLKIRVGGGMAADVAKAVGASPIAKPAPESYELLSTGVADGVFFPAESLVSFKLDSI
FT                   IRHATEFPGGLYSDTHAVIINRDAFARLSKQDQDTLVRLSGRHLAELAGRAWDTHDAAA
FT                   RKVLEGGEIELVKADDALIEAVRERTKGFEQAWLDAAKAKGIDGPAALASFRAEIKQLD
FT                   QQR"
     MMHKTLAAAL FALGLAGTAP AIAQKPVELT LSSWLPPTHA VVADFLMPWG EEIRKATDGR        60
     VTLRLLPKAV TNPAGHFDAV RDGLVDVTFV SHAYYPGRFQ LTKFAVLPFS GDTATSRSIA       120
     AWDTYEKYLL KADEHKGVRL LGIYAHGPGI AFTTSKPVKQ IGDFQGLKIR VGGGMAADVA       180
     KAVGASPIAK PAPESYELLS TGVADGVFFP AESLVSFKLD SIIRHATEFP GGLYSDTHAV       240
     IINRDAFARL SKQDQDTLVR LSGRHLAELA GRAWDTHDAA ARKVLEGGEI ELVKADDALI       300
     EAVRERTKGF EQAWLDAAKA KGIDGPAALA SFRAEIKQLD QQR                         343
//

If you have problems or comments...

PBIL Back to PBIL home page