(data stored in ACNUC1104 zone)

EMBL: BX640427.PE86

BX640427.PE86        Location/Qualifiers
FT   CDS             complement(83531..84490)
FT                   /transl_table=11
FT                   /locus_tag="BPP1377"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Alcaligenes eutrophus hypothetical 34.2
FT                   kDa protein in gbd 5'region SWALL:Q44016 (EMBL:L36817) (324
FT                   aa) fasta scores: E(): 6.5e-35, 41% id in 317 aa, and to
FT                   Yersinia pestis hypothetical protein Ypo2238 SWALL:Q8ZED6
FT                   (EMBL:AJ414151) (333 aa) fasta scores: E(): 1.9e-31, 35.64%
FT                   id in 317 aa"
FT                   /db_xref="GOA:Q7WAJ9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAJ9"
FT                   /protein_id="CAE36679.1"
FT                   /translation="MRVLITGANGYIGRALAERLCALPGVPGYGALEQLTLCDLAFDAA
FT                   PADPRVRQVAGDFADPATLAAITDPPPDLVFHLACVASGRAELEFELGLRVNLEGSLRL
FT                   LEQLRRQGRSPGLVFTSSIAVYGAPLPALVTDDTPLAPALSYGAQKQAVEILLADYTRR
FT                   GFVRGRAVRLPGVAPRPPAPNGAWSAFSSTLLRALAAGQPCEMPVGPQATLWLMSLPCC
FT                   VDNLLRAAELTAQAPPPGGRTGWTLPALRVSVRDIVQAFDARSQGAATPLVSYTPRPDI
FT                   EAQFGNQPPLQCDAAQAAGFRHDSSLPALLERAVGPPP"
     MRVLITGANG YIGRALAERL CALPGVPGYG ALEQLTLCDL AFDAAPADPR VRQVAGDFAD        60
     PATLAAITDP PPDLVFHLAC VASGRAELEF ELGLRVNLEG SLRLLEQLRR QGRSPGLVFT       120
     SSIAVYGAPL PALVTDDTPL APALSYGAQK QAVEILLADY TRRGFVRGRA VRLPGVAPRP       180
     PAPNGAWSAF SSTLLRALAA GQPCEMPVGP QATLWLMSLP CCVDNLLRAA ELTAQAPPPG       240
     GRTGWTLPAL RVSVRDIVQA FDARSQGAAT PLVSYTPRPD IEAQFGNQPP LQCDAAQAAG       300
     FRHDSSLPAL LERAVGPPP                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page