(data stored in ACNUC1104 zone)

EMBL: BX640427.PE87

BX640427.PE87        Location/Qualifiers
FT   CDS             complement(84478..85284)
FT                   /transl_table=11
FT                   /locus_tag="BPP1378"
FT                   /product="putative exported protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa0550 SWALL:Q9I5Y6 (EMBL:AE004491) (265 aa) fasta
FT                   scores: E(): 8.6e-34, 46.12% id in 258 aa, and to Ralstonia
FT                   solanacearum hypothetical protein Rsc0020 or Rs01842
FT                   SWALL:Q8Y3G0 (EMBL:AL646057) (262 aa) fasta scores: E():
FT                   1.6e-32, 43.96% id in 257 aa"
FT                   /db_xref="GOA:Q7WAJ8"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAJ8"
FT                   /protein_id="CAE36680.1"
FT                   /translation="MKLAANLTLLYPGLPLAARMAAAREDGFAGVEILFPYDQPPAQLA
FT                   AQLREHGLALALVNTPLGAAGEKGLACVPGREADFGAALDQALALCRATGCRIVHAMAG
FT                   MPPAPAGMDECRATLIGNLQRAAPRAAQAGVTLTLEPLNRADMPGYFYYLPEQAADIIR
FT                   AVDHPNVGLQFDIYHNLREGLDPHAELRRVLPLVRHVQFAGPDGRHEPDPASPPVAATL
FT                   RLLAQSGYGGWMGCEYTPRGLASAGLKAWRGAYDAACGSGGAACAS"
     MKLAANLTLL YPGLPLAARM AAAREDGFAG VEILFPYDQP PAQLAAQLRE HGLALALVNT        60
     PLGAAGEKGL ACVPGREADF GAALDQALAL CRATGCRIVH AMAGMPPAPA GMDECRATLI       120
     GNLQRAAPRA AQAGVTLTLE PLNRADMPGY FYYLPEQAAD IIRAVDHPNV GLQFDIYHNL       180
     REGLDPHAEL RRVLPLVRHV QFAGPDGRHE PDPASPPVAA TLRLLAQSGY GGWMGCEYTP       240
     RGLASAGLKA WRGAYDAACG SGGAACAS                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page