(data stored in ACNUC1104 zone)

EMBL: BX640427.PE88

BX640427.PE88        Location/Qualifiers
FT   CDS             complement(85281..86177)
FT                   /transl_table=11
FT                   /locus_tag="BPP1379"
FT                   /product="probable dehydrogenase"
FT                   /note="Similar to Escherichia coli
FT                   2-hydroxy-3-oxopropionate reductase GarR or B3125
FT                   SWALL:GARR_ECOLI (SWALL:P23523) (294 aa) fasta scores: E():
FT                   6.9e-20, 33.21% id in 277 aa, and to Pseudomonas aeruginosa
FT                   probable 3-hydroxyisobutyrate dehydrogenase Pa3312
FT                   SWALL:Q9HYT2 (EMBL:AE004753) (296 aa) fasta scores: E():
FT                   8.3e-38, 47.97% id in 296 aa"
FT                   /db_xref="GOA:Q7WAJ7"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAJ7"
FT                   /protein_id="CAE36681.1"
FT                   /translation="MSATLAFCGAGLMGAPMIRRLLAAGHRVRVWNRSAAKAQALAADG
FT                   AVVCATPAEAAAGAQAVLLCLTDLAAVQATVFGPHGVADVAGGLLVDHSSIEPDATRAL
FT                   AARLLAASGRVWIDAPVSGGVAGAQAGTLSILAGGPAAAIEAAQPWLRAYAGRVTRLGD
FT                   TGAGQIGKLCNQTIVATTVNAIAEAVALARRNGIDVAALDTALAGGWADSVLLRIFVPR
FT                   MTAPVDQPLGALQTMLKNLENVAALAAASGTQLRGLQGVLDSYRTAAARGLGPGDLSDI
FT                   VRVAWPERPAAPTREPA"
     MSATLAFCGA GLMGAPMIRR LLAAGHRVRV WNRSAAKAQA LAADGAVVCA TPAEAAAGAQ        60
     AVLLCLTDLA AVQATVFGPH GVADVAGGLL VDHSSIEPDA TRALAARLLA ASGRVWIDAP       120
     VSGGVAGAQA GTLSILAGGP AAAIEAAQPW LRAYAGRVTR LGDTGAGQIG KLCNQTIVAT       180
     TVNAIAEAVA LARRNGIDVA ALDTALAGGW ADSVLLRIFV PRMTAPVDQP LGALQTMLKN       240
     LENVAALAAA SGTQLRGLQG VLDSYRTAAA RGLGPGDLSD IVRVAWPERP AAPTREPA         298
//

If you have problems or comments...

PBIL Back to PBIL home page