(data stored in ACNUC1104 zone)

EMBL: BX640427.PE91

BX640427.PE91        Location/Qualifiers
FT   CDS             complement(88704..89390)
FT                   /transl_table=11
FT                   /locus_tag="BPP1382"
FT                   /product="probable GntR-family transcriptional regulator"
FT                   /note="Similar to Rhizobium loti probable transcriptional
FT                   regulator Mlr2114 SWALL:Q98J42 (EMBL:AP002999) (223 aa)
FT                   fasta scores: E(): 2.2e-26, 45.45% id in 198 aa, and to
FT                   Agrobacterium rhizogenes Riorf32 protein SWALL:Q9F5G0
FT                   (EMBL:AP002086) (217 aa) fasta scores: E(): 2.6e-12, 32.99%
FT                   id in 197 aa"
FT                   /db_xref="GOA:Q7WAJ4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAJ4"
FT                   /protein_id="CAE36684.1"
FT                   /translation="MTLTALPADPPPADALDLDLAVEQLEEDIVFGRLFPRQRLTEDEL
FT                   MARFGLKRHAVRQVLAQLEQRGAVERKRNVGAEVRAFTAREVMDLYDLRELLETRAAER
FT                   IALPVDEARLAALVAVQREHDAAVAAGNARRVFRSNQRFHRELFGLLDNPVLQQAIEEY
FT                   ARRTHPIRFGSLAAAGYRERARQEHWAMIQALRQGDRAALVALCRNHLLPSRDAYLAAA
FT                   GLRASA"
     MTLTALPADP PPADALDLDL AVEQLEEDIV FGRLFPRQRL TEDELMARFG LKRHAVRQVL        60
     AQLEQRGAVE RKRNVGAEVR AFTAREVMDL YDLRELLETR AAERIALPVD EARLAALVAV       120
     QREHDAAVAA GNARRVFRSN QRFHRELFGL LDNPVLQQAI EEYARRTHPI RFGSLAAAGY       180
     RERARQEHWA MIQALRQGDR AALVALCRNH LLPSRDAYLA AAGLRASA                    228
//

If you have problems or comments...

PBIL Back to PBIL home page