(data stored in ACNUC1104 zone)

EMBL: BX640427.PE92

BX640427.PE92        Location/Qualifiers
FT   CDS             complement(89397..91139)
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="BPP1383"
FT                   /product="putative dihydroxy-acid dehydratase"
FT                   /note="Similar to Agrobacterium tumefaciens dihydroxy-acid
FT                   dehydratase IlvD or Atu3971 or Agr_l_1769 SWALL:AAL44773
FT                   (EMBL:AE009327) (574 aa) fasta scores: E(): 1.3e-95, 47.92%
FT                   id in 553 aa, and to Rhizobium meliloti putative
FT                   dihydroxy-acid dehydratase protein IlvD1 or R00822 or
FT                   Smc00884 SWALL:Q92RP0 (EMBL:AL591785) (574 aa) fasta
FT                   scores: E(): 4.5e-92, 49.09% id in 550 aa"
FT                   /db_xref="GOA:Q7WAJ3"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAJ3"
FT                   /protein_id="CAE36685.1"
FT                   /translation="MTQRDQGGKPPGGLSKGLTNYGDTGFSLFLRKAFIKGAGYTDDAL
FT                   ARPVIGIVNTGSSYNPCHGNAPQLVEAVKRGVMLAGGLPVDFPTISVHESFSQPTSMYL
FT                   RNLMSMDTEEMIRAQPMDAVVLIGGCDKTVPAQLMGAASAGVPAIQLVTGSMLTGSHRG
FT                   ERVGACTDCRRYWGRYRADEIDTAEITDVNNQLVASVGTCSVMGTASTMACLTEALGMM
FT                   ISGGASAPAVTADRIRVAERTGATAVAMAAARLTPERILTGKAIENALRVLLAIGGSTN
FT                   GIVHLTAIAGRLGIDIDLTGLDRMSRETPVLVDLKPSGQHYMEDFHKAGGMPALLRELR
FT                   PLLHLDALTVSGRTLGEELDAAPAPFAQEVIRAFDAPIYPVGGLAVLRGNLAPGGAIIK
FT                   QSAADARLMEHEGRAVVFEDAEDMARRIDDDALDVTADDILVLKRIGPTGAPGMPEAGY
FT                   MPIPRKLARAGVKDMVRVSDGRMSGTAAGTIVLHVTPEAAIGGPLAHVRNGDRIRLSVR
FT                   QREISLLVSEAELAQRAAAQPIERPQAERGYRKLFLDTVTQADQGVDFDFLRAPASKQT
FT                   VPPR"
     MTQRDQGGKP PGGLSKGLTN YGDTGFSLFL RKAFIKGAGY TDDALARPVI GIVNTGSSYN        60
     PCHGNAPQLV EAVKRGVMLA GGLPVDFPTI SVHESFSQPT SMYLRNLMSM DTEEMIRAQP       120
     MDAVVLIGGC DKTVPAQLMG AASAGVPAIQ LVTGSMLTGS HRGERVGACT DCRRYWGRYR       180
     ADEIDTAEIT DVNNQLVASV GTCSVMGTAS TMACLTEALG MMISGGASAP AVTADRIRVA       240
     ERTGATAVAM AAARLTPERI LTGKAIENAL RVLLAIGGST NGIVHLTAIA GRLGIDIDLT       300
     GLDRMSRETP VLVDLKPSGQ HYMEDFHKAG GMPALLRELR PLLHLDALTV SGRTLGEELD       360
     AAPAPFAQEV IRAFDAPIYP VGGLAVLRGN LAPGGAIIKQ SAADARLMEH EGRAVVFEDA       420
     EDMARRIDDD ALDVTADDIL VLKRIGPTGA PGMPEAGYMP IPRKLARAGV KDMVRVSDGR       480
     MSGTAAGTIV LHVTPEAAIG GPLAHVRNGD RIRLSVRQRE ISLLVSEAEL AQRAAAQPIE       540
     RPQAERGYRK LFLDTVTQAD QGVDFDFLRA PASKQTVPPR                             580
//

If you have problems or comments...

PBIL Back to PBIL home page