(data stored in ACNUC1104 zone)

EMBL: BX640427.PE93

BX640427.PE93        Location/Qualifiers
FT   CDS             91372..92376
FT                   /transl_table=11
FT                   /locus_tag="BPP1384"
FT                   /product="putative exported protein"
FT                   /note="Similar to Comamonas testosteroni OrfJ protein
FT                   SWALL:Q9RHM9 (EMBL:AB029044) (326 aa) fasta scores: E():
FT                   1.7e-46, 45.12% id in 328 aa, and to Rhizobium meliloti
FT                   hypothetical protein Ra1058 ra1058 or sma1927 SWALL:Q92Y30
FT                   (EMBL:AE007292) (330 aa) fasta scores: E(): 2.1e-52, 45.87%
FT                   id in 327 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAJ2"
FT                   /protein_id="CAE36686.1"
FT                   /translation="MSDRQSARLPRRAALCSMLALCAGFALQPVAAQSAYPDRPIRMIV
FT                   PYPPGGATDVIGRVLAKEMSGALGQSVVVENRAGAAGNIGADVVAKATPDGYTILMGAM
FT                   TSHAINAVLYQGRVSYDIEKSFAPVAIVGTVPLVFVVNPAVPADSLQSLIALAKSKPGY
FT                   LTMASAGNGSPQHLAGEMFKRVAGVDLLHVPYKGSGPAMTDLMGGQVLSMIETVPAAQG
FT                   NVKGGKLRALAVASAQRVESLPDVPTTAEAGLPNFQVSSMFGIAAPAGTPVPVVERLNA
FT                   VLKEALAKPEVQTALLNQGAISTWTTPADAAARISAERQQWATVIAEAGVKAE"
     MSDRQSARLP RRAALCSMLA LCAGFALQPV AAQSAYPDRP IRMIVPYPPG GATDVIGRVL        60
     AKEMSGALGQ SVVVENRAGA AGNIGADVVA KATPDGYTIL MGAMTSHAIN AVLYQGRVSY       120
     DIEKSFAPVA IVGTVPLVFV VNPAVPADSL QSLIALAKSK PGYLTMASAG NGSPQHLAGE       180
     MFKRVAGVDL LHVPYKGSGP AMTDLMGGQV LSMIETVPAA QGNVKGGKLR ALAVASAQRV       240
     ESLPDVPTTA EAGLPNFQVS SMFGIAAPAG TPVPVVERLN AVLKEALAKP EVQTALLNQG       300
     AISTWTTPAD AAARISAERQ QWATVIAEAG VKAE                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page