(data stored in ACNUC1104 zone)

EMBL: BX640427.PE96

BX640427.PE96        Location/Qualifiers
FT   CDS             complement(95076..95897)
FT                   /transl_table=11
FT                   /locus_tag="BPP1387"
FT                   /product="ATP-binding component of ABC transporter"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   ABC-transport protein, ATP-binding component Sc8g12.21
FT                   SWALL:Q9KYY4 (EMBL:AL355753) (270 aa) fasta scores: E():
FT                   2.8e-40, 46.79% id in 265 aa, and to Agrobacterium
FT                   tumefaciens ABC transporter, nucleotide binding/ATPase
FT                   protein Atu0159 or Agr_c_259 SWALL:AAK85980 (EMBL:AE008990)
FT                   (266 aa) fasta scores: E(): 7.9e-40, 46.56% id in 262 aa"
FT                   /db_xref="GOA:Q7WAJ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAJ0"
FT                   /protein_id="CAE36689.1"
FT                   /translation="MSATPASDVRIRFEDVCVDYPTADGPMRVLDGINYEIRQGEFVSV
FT                   IGPSGCGKTTMMGLVGGFVQPTAGRVLLDGQPVGGPGPDRGVIFQEYGVFPWLTVRENI
FT                   AFGLNLRSNRVAAGERAQICQRYMTLMGLSDFAHHYPKHLSGGMRQRLALARAYAVKPQ
FT                   FLLMDEPFGALDAQTRSAMQDLLLQVQMTEGKTVMLITHSVEEAIYLSSRIVVVTARPA
FT                   RIRTIIDVPFGYPRAENLHEDPRFGELRSHIRALVMEEYAKQARQTVRLSD"
     MSATPASDVR IRFEDVCVDY PTADGPMRVL DGINYEIRQG EFVSVIGPSG CGKTTMMGLV        60
     GGFVQPTAGR VLLDGQPVGG PGPDRGVIFQ EYGVFPWLTV RENIAFGLNL RSNRVAAGER       120
     AQICQRYMTL MGLSDFAHHY PKHLSGGMRQ RLALARAYAV KPQFLLMDEP FGALDAQTRS       180
     AMQDLLLQVQ MTEGKTVMLI THSVEEAIYL SSRIVVVTAR PARIRTIIDV PFGYPRAENL       240
     HEDPRFGELR SHIRALVMEE YAKQARQTVR LSD                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page