(data stored in ACNUC1104 zone)

EMBL: BX640427.PE97

BX640427.PE97        Location/Qualifiers
FT   CDS             complement(95917..96684)
FT                   /transl_table=11
FT                   /locus_tag="BPP1388"
FT                   /product="permease component of ABC transporter"
FT                   /note="Similar to Escherichia coli taurine transport system
FT                   permease protein TauC or SsiC or B0367 SWALL:TAUC_ECOLI
FT                   (SWALL:Q47539) (275 aa) fasta scores: E(): 6.8e-30, 34.48%
FT                   id in 261 aa, and to Brucella melitensis taurine transport
FT                   system permease protein tauc bmeii0107 SWALL:Q8YDR8
FT                   (EMBL:AE009649) (246 aa) fasta scores: E(): 4e-36, 46.05%
FT                   id in 228 aa"
FT                   /db_xref="GOA:Q7WAI9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAI9"
FT                   /protein_id="CAE36690.1"
FT                   /translation="MKRRSALMRALLVLAPWLLIVLLWYGIRASGLVSPALVPSPGEVW
FT                   TRFVALMQARLPHDILMSTQRVFVGVCLGTLLAVPVGFVLGWYRGVRSFIDPVINFFRA
FT                   LPPIALIPLVIVYFGIGETAKIAILFYASFFAGVIVMYEGISQINPIFVRVAKTLGATD
FT                   GEIFRKVIVPLTIPHMLTALRVALGVAWATLVASELIAAQQGLGALIQDASSFFQLDII
FT                   YVGIICIGFIALAMDLALRAAARRLVAWQDRIA"
     MKRRSALMRA LLVLAPWLLI VLLWYGIRAS GLVSPALVPS PGEVWTRFVA LMQARLPHDI        60
     LMSTQRVFVG VCLGTLLAVP VGFVLGWYRG VRSFIDPVIN FFRALPPIAL IPLVIVYFGI       120
     GETAKIAILF YASFFAGVIV MYEGISQINP IFVRVAKTLG ATDGEIFRKV IVPLTIPHML       180
     TALRVALGVA WATLVASELI AAQQGLGALI QDASSFFQLD IIYVGIICIG FIALAMDLAL       240
     RAAARRLVAW QDRIA                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page