(data stored in ACNUC1104 zone)

EMBL: BX640427.PE99

BX640427.PE99        Location/Qualifiers
FT   CDS             97517..98665
FT                   /transl_table=11
FT                   /locus_tag="BPP1390"
FT                   /product="putative mandelate racemase/muconate lactonizing
FT                   enzyme"
FT                   /note="Similar to Streptomyces coelicolor putative racemase
FT                   Sce65.16C SWALL:Q9RKF7 (EMBL:AL133236) (361 aa) fasta
FT                   scores: E(): 4e-21, 32.43% id in 370 aa, and to
FT                   Agrobacterium tumefaciens hypothetical protein Atu3139 or
FT                   Agr_l_3340 SWALL:AAL43955 (EMBL:AE009244) (378 aa) fasta
FT                   scores: E(): 6.4e-26, 32.36% id in 377 aa"
FT                   /db_xref="GOA:Q7WAI7"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAI7"
FT                   /protein_id="CAE36692.1"
FT                   /translation="MTRDAAPITPARVRAHVFRYPVSTPVKTSFGTMHDRPAVLVEVED
FT                   SDGAVGWGEVWCNFPACGAEHRARLVETVLAPLLTARAFADPAQAFAHLEARTAVLAIQ
FT                   TGEPGPLAQAIAGLDIALCDLAARRAGEPLWAWLGGSGDRIGVYASGINPENPEDVVAR
FT                   KAAEGYRAFKLKVGFDDARDVRNALHVRELLGAATPLMADANQGWDLPRARQMAQRLGP
FT                   AQLDWLEEPLRADRPAAEWAELAQAAPMPLAGGENIAGVAAFETALAARSLRVMQPDLA
FT                   KWGGFSGCLPVARAVVAAGLRYCPHYLGAGIGLQASAHLLAAVPGLASPGLLEVDANDN
FT                   PLRSLLSPALATLHEGRITLGGAPGLGVTPDLAALRAACAAR"
     MTRDAAPITP ARVRAHVFRY PVSTPVKTSF GTMHDRPAVL VEVEDSDGAV GWGEVWCNFP        60
     ACGAEHRARL VETVLAPLLT ARAFADPAQA FAHLEARTAV LAIQTGEPGP LAQAIAGLDI       120
     ALCDLAARRA GEPLWAWLGG SGDRIGVYAS GINPENPEDV VARKAAEGYR AFKLKVGFDD       180
     ARDVRNALHV RELLGAATPL MADANQGWDL PRARQMAQRL GPAQLDWLEE PLRADRPAAE       240
     WAELAQAAPM PLAGGENIAG VAAFETALAA RSLRVMQPDL AKWGGFSGCL PVARAVVAAG       300
     LRYCPHYLGA GIGLQASAHL LAAVPGLASP GLLEVDANDN PLRSLLSPAL ATLHEGRITL       360
     GGAPGLGVTP DLAALRAACA AR                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page