(data stored in ACNUC1104 zone)

EMBL: BX640427.PPHA

BX640427.PPHA        Location/Qualifiers
FT   CDS             343549..344283
FT                   /transl_table=11
FT                   /gene="pphA"
FT                   /gene_synonym="prpA"
FT                   /locus_tag="BPP1630"
FT                   /product="serine/threonine protein phosphatase 1"
FT                   /EC_number="3.1.3.16"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0904"
FT                   /db_xref="GOA:Q7W9W9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9W9"
FT                   /protein_id="CAE36931.1"
FT                   /translation="MAPNLQYPAFLRLPRNPAGRDFAVGDIHGHFSRLEQALDECGFDP
FT                   RRDRLFSVGDLIDRGPDSEAAVQWLAHPWFYAVQGNHEDYAIRHVRTGLVDQDNWRSYG
FT                   GGWFLDAAPERQRAWAGAFAALPVVIEVATQAGPVGLLHADCPVRDWSRLEYFLQARPK
FT                   RARSVCQWSRERLASGDARGVDGIRAVVAGHTPVSEPVVLGNVYHIDTQGWRPHGYFTL
FT                   LDLSTLSAWPRPAQAGAPAARG"
     MAPNLQYPAF LRLPRNPAGR DFAVGDIHGH FSRLEQALDE CGFDPRRDRL FSVGDLIDRG        60
     PDSEAAVQWL AHPWFYAVQG NHEDYAIRHV RTGLVDQDNW RSYGGGWFLD AAPERQRAWA       120
     GAFAALPVVI EVATQAGPVG LLHADCPVRD WSRLEYFLQA RPKRARSVCQ WSRERLASGD       180
     ARGVDGIRAV VAGHTPVSEP VVLGNVYHID TQGWRPHGYF TLLDLSTLSA WPRPAQAGAP       240
     AARG                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page