(data stored in ACNUC1104 zone)

EMBL: BX640427.PYRH

BX640427.PYRH        Location/Qualifiers
FT   CDS             242297..242959
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /gene_synonym="smbA"
FT                   /locus_tag="BPP1529"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1421"
FT                   /db_xref="GOA:Q7WA58"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WA58"
FT                   /protein_id="CAE36831.1"
FT                   /translation="MGEDAFGINRSTIVRMTDEIAEVAALGVELAIVIGGGNIFRGVAP
FT                   GAQGMDRATADYMGMMATIMNALALQDALKHKGVDTRVQSALNIDQVVEPYIRPKALRY
FT                   LEEGKVVIFAAGTGNPFFTTDTAAALRGAEIGAEIVLKATKVDGIYSADPNKDPTATRY
FT                   ARISFDEAIVRRLEVMDATAFALCRDQKLPIKVFSINKFGALKRAVSGEDEGTLVHV"
     MGEDAFGINR STIVRMTDEI AEVAALGVEL AIVIGGGNIF RGVAPGAQGM DRATADYMGM        60
     MATIMNALAL QDALKHKGVD TRVQSALNID QVVEPYIRPK ALRYLEEGKV VIFAAGTGNP       120
     FFTTDTAAAL RGAEIGAEIV LKATKVDGIY SADPNKDPTA TRYARISFDE AIVRRLEVMD       180
     ATAFALCRDQ KLPIKVFSIN KFGALKRAVS GEDEGTLVHV                             220
//

If you have problems or comments...

PBIL Back to PBIL home page