(data stored in ACNUC1104 zone)

EMBL: BX640427.RPSB

BX640427.RPSB        Location/Qualifiers
FT   CDS             240334..241083
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="BPP1527"
FT                   /product="30S ribosomal protein S2"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1419"
FT                   /db_xref="GOA:Q7WA60"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WA60"
FT                   /protein_id="CAE36829.1"
FT                   /translation="MSLMREMLEAGVHFGHQTRYWNPKMAPYIFGHRNKIHIINLEQTV
FT                   AKYQEASKFVKQLVARGGNILFVGTKRAARELVATEAARCGMPYVDARWLGGMLTNFKT
FT                   VKSSIKRLKDMEAMVADGGFERMTKKEGLLFQRELDKLNKSIGGIKDMNGLPDALFVID
FT                   VGYHKIAVAEAKVLGIPVVAVVDTNHSPDGIDHVIPGNDDSARAIALYAKGMADAVLEG
FT                   REQNINGLVEEIGEGQEEFVEVQDNQA"
     MSLMREMLEA GVHFGHQTRY WNPKMAPYIF GHRNKIHIIN LEQTVAKYQE ASKFVKQLVA        60
     RGGNILFVGT KRAARELVAT EAARCGMPYV DARWLGGMLT NFKTVKSSIK RLKDMEAMVA       120
     DGGFERMTKK EGLLFQRELD KLNKSIGGIK DMNGLPDALF VIDVGYHKIA VAEAKVLGIP       180
     VVAVVDTNHS PDGIDHVIPG NDDSARAIAL YAKGMADAVL EGREQNINGL VEEIGEGQEE       240
     FVEVQDNQA                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page