(data stored in ACNUC1104 zone)

EMBL: BX640427.SMPB

BX640427.SMPB        Location/Qualifiers
FT   CDS             complement(262823..263290)
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /gene_synonym="smqB"
FT                   /locus_tag="BPP1549"
FT                   /product="SsrA-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1442"
FT                   /db_xref="GOA:Q7WA41"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WA41"
FT                   /protein_id="CAE36851.1"
FT                   /translation="MSIIDNRKATHDYFIEDRYEAGMVLEGWEVKAIRDGRVHLKESYV
FT                   IVRDGEIYLLGMHVSPLPTASTHIRPDATRTRKLLLKAEEIRKLIGKVEQRGYTLVPLN
FT                   LHYKNGRIKLDFALGRGKKLYDKRDTAREKDWQREKERVLKHDTRVNQRDS"
     MSIIDNRKAT HDYFIEDRYE AGMVLEGWEV KAIRDGRVHL KESYVIVRDG EIYLLGMHVS        60
     PLPTASTHIR PDATRTRKLL LKAEEIRKLI GKVEQRGYTL VPLNLHYKNG RIKLDFALGR       120
     GKKLYDKRDT AREKDWQREK ERVLKHDTRV NQRDS                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page