(data stored in ACNUC1104 zone)

EMBL: BX640427.STBB

BX640427.STBB        Location/Qualifiers
FT   CDS             complement(110237..110662)
FT                   /transl_table=11
FT                   /gene="stbB"
FT                   /locus_tag="BPP1402"
FT                   /product="putative plasmid stability protein"
FT                   /note="Similar to Pseudomonas syringae plasmid stability
FT                   protein StbB SWALL:STBB_PSESM (SWALL:Q52562) (139 aa) fasta
FT                   scores: E(): 1.3e-20, 46.76% id in 139 aa, and to Rhizobium
FT                   sp. putative plasmid stability protein Y4jK
FT                   SWALL:Y4JK_RHISN (SWALL:P55511) (140 aa) fasta scores: E():
FT                   2.9e-21, 48.57% id in 140 aa"
FT                   /db_xref="GOA:Q7WAH5"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAH5"
FT                   /protein_id="CAE36704.1"
FT                   /translation="MILLDTDVLLEPLRPAPDPAVAAWLDAQHVETLYLAAPGAAEIQL
FT                   GLARLPRGKRAEALRHEFERRVLPLFMGHVLPFDTAAADAYAAVMMRAAAAGHALCAID
FT                   GCIAAIATAHGLAIATRHPARFEAAGLAAVDPWHAAA"
     MILLDTDVLL EPLRPAPDPA VAAWLDAQHV ETLYLAAPGA AEIQLGLARL PRGKRAEALR        60
     HEFERRVLPL FMGHVLPFDT AAADAYAAVM MRAAAAGHAL CAIDGCIAAI ATAHGLAIAT       120
     RHPARFEAAG LAAVDPWHAA A                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page