(data stored in ACNUC1104 zone)

EMBL: BX640427.STBC

BX640427.STBC        Location/Qualifiers
FT   CDS             complement(110659..110898)
FT                   /transl_table=11
FT                   /gene="stbC"
FT                   /locus_tag="BPP1403"
FT                   /product="putative plasmid stability protein"
FT                   /note="Similar to Pseudomonas syringae plasmid stability
FT                   protein StbC SWALL:STBC_PSESM (SWALL:Q52561) (103 aa) fasta
FT                   scores: E(): 8.2e-12, 51.76% id in 85 aa, and to Rhizobium
FT                   sp. putative plasmid stability protein Y4jJ
FT                   SWALL:Y4JJ_RHISN (SWALL:P55510) (85 aa) fasta scores: E():
FT                   1.5e-13, 60% id in 85 aa"
FT                   /db_xref="GOA:Q7WAH4"
FT                   /db_xref="InterPro:IPR005569"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAH4"
FT                   /protein_id="CAE36705.1"
FT                   /translation="MSSITVRNVPEEVHRALRVRAATHGRSTEAEIRAILENAVLPDGR
FT                   VKLGTLLSHIGRGARGMDLTIERNPAPARPASFE"
     MSSITVRNVP EEVHRALRVR AATHGRSTEA EIRAILENAV LPDGRVKLGT LLSHIGRGAR        60
     GMDLTIERNP APARPASFE                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page