(data stored in ACNUC1104 zone)

EMBL: BX640427.TSR

BX640427.TSR         Location/Qualifiers
FT   CDS             186746..188452
FT                   /transl_table=11
FT                   /gene="tsr"
FT                   /gene_synonym="cheD"
FT                   /locus_tag="BPP1474"
FT                   /product="methyl-accepting chemotaxis protein I"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1030"
FT                   /db_xref="GOA:Q7WAA6"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAA6"
FT                   /protein_id="CAE36776.1"
FT                   /translation="MRKFLANLSIRGSLLGVLAFFSFMLVVGAALGVLSLRVSNDTLQG
FT                   VKQTQDVADAMDRVVNSYKDAFNGLGRAAASHYGAIVSAIGQPVQVEQGLGSEAAGLLQ
FT                   RAKASLNRAETEYEYYKGLARPASAADSLKEVENAFEALVGQGLHPLAAALEKGDMAGY
FT                   QSHAQNVLDALEGRFSGAIAAFDFWRASELLDAHEVAETRYRFVLAAVAAGGVLAALLV
FT                   FSTYLFLRRRVLQPLREVGQHFDKIAAGDLTARVDVRNSNEIGQLFAGLKRMEESLTRT
FT                   VAAVRRGVDEINVGSREISAGNTDLSSRTEEQAASLEETAASMEQLASTVKQNADNARQ
FT                   ANQLAGVASDVAERGGSAVSEVVATMQDISASSRKISEIVSVIDGIAFQTNILALNAAV
FT                   EAARAGEQGKGFAVVAGEVRSLAQRSAQAAKEIKVLIEDSVGKVGTGSQQVERAGATMQ
FT                   EIVASVKRVTDIMGEISAASEEQSSGIEQVNRAVSQMDEVTQQNAALVEEAAAAAGSLQ
FT                   EQAQRLAEAVAVFRINAGEVIEVPAHQLGSRQAPGARETALAHDDALALGH"
     MRKFLANLSI RGSLLGVLAF FSFMLVVGAA LGVLSLRVSN DTLQGVKQTQ DVADAMDRVV        60
     NSYKDAFNGL GRAAASHYGA IVSAIGQPVQ VEQGLGSEAA GLLQRAKASL NRAETEYEYY       120
     KGLARPASAA DSLKEVENAF EALVGQGLHP LAAALEKGDM AGYQSHAQNV LDALEGRFSG       180
     AIAAFDFWRA SELLDAHEVA ETRYRFVLAA VAAGGVLAAL LVFSTYLFLR RRVLQPLREV       240
     GQHFDKIAAG DLTARVDVRN SNEIGQLFAG LKRMEESLTR TVAAVRRGVD EINVGSREIS       300
     AGNTDLSSRT EEQAASLEET AASMEQLAST VKQNADNARQ ANQLAGVASD VAERGGSAVS       360
     EVVATMQDIS ASSRKISEIV SVIDGIAFQT NILALNAAVE AARAGEQGKG FAVVAGEVRS       420
     LAQRSAQAAK EIKVLIEDSV GKVGTGSQQV ERAGATMQEI VASVKRVTDI MGEISAASEE       480
     QSSGIEQVNR AVSQMDEVTQ QNAALVEEAA AAAGSLQEQA QRLAEAVAVF RINAGEVIEV       540
     PAHQLGSRQA PGARETALAH DDALALGH                                          568
//

If you have problems or comments...

PBIL Back to PBIL home page