(data stored in ACNUC9435 zone)

EMBL: BX936399.PE1

BX936399.PE1         Location/Qualifiers
FT   CDS             complement(12..2210)
FT                   /transl_table=11
FT                   /locus_tag="pYV0001"
FT                   /product="ypkA; putative targeted effector protein kinase"
FT                   /note="similar to Y. pestis YPCD1.72c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25344"
FT                   /db_xref="GOA:Q05608"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003547"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR019093"
FT                   /db_xref="PDB:2H7O"
FT                   /db_xref="PDB:2H7V"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q05608"
FT                   /protein_id="CAF25344.1"
FT                   /translation="MKSVKIMGTMPPSISLAKAHERISQHWQNPVGELNIGGKRYRIID
FT                   NQVLRLNPHSGFSLFREGVGKIFSGKMFNFSIARNLTDTLHAAQKTTSQELRSDIPNAL
FT                   SNLFGAKPQTELPLGWKGEPLSGAPDLEGMRVAETDKFAEGESHISIIETKDKQRLVAK
FT                   IERSIAEGHLFAELEAYKHIYKTAGKHPNLANVHGMAVVPYGNRKEEALLMDEVDGWRC
FT                   SDTLRTLADSWKQGKINSEAYWGTIKFIAHRLLDVTNHLAKAGVVHNDIKPGNVVFDRA
FT                   SGEPVVIDLGLHSRSGEQPKGFTESFKAPELGVGNLGASEKSDVFLVVSTLLHCIEGFE
FT                   KNPEIKPNQGLRFITSEPAHVMDENGYPIHRPGIAGVETAYTRFITDILGVSADSRPDS
FT                   NEARLHEFLSDGTIDEESAKQILKDTLTGEMSPLSTDVRRITPKKLRELSDLLRTHLSS
FT                   AATKQLDMGGVLSDLDTMLVALDKAEREGGVDKDQLKSFNSLILKTYRVIEDYVKGREG
FT                   DTKNSSTEVSPYHRSNFMLSIVEPSLQRIQKHLDQTHSFSDIGSLVRAHKHLETLLEVL
FT                   VTLSQQGQPVSSETYGFLNRLAEAKITLSQQLNTLQQQQESAKAQLSILINRSGSWADV
FT                   ARQSLQRFDSTRPVVKFGTEQYTAIHRQMMAAHAAITLQEVSEFTDDMRNFTVDSIPLL
FT                   IQLGRSSLMDEHLVEQREKLRELTTIAERLNRLEREWM"
     MKSVKIMGTM PPSISLAKAH ERISQHWQNP VGELNIGGKR YRIIDNQVLR LNPHSGFSLF        60
     REGVGKIFSG KMFNFSIARN LTDTLHAAQK TTSQELRSDI PNALSNLFGA KPQTELPLGW       120
     KGEPLSGAPD LEGMRVAETD KFAEGESHIS IIETKDKQRL VAKIERSIAE GHLFAELEAY       180
     KHIYKTAGKH PNLANVHGMA VVPYGNRKEE ALLMDEVDGW RCSDTLRTLA DSWKQGKINS       240
     EAYWGTIKFI AHRLLDVTNH LAKAGVVHND IKPGNVVFDR ASGEPVVIDL GLHSRSGEQP       300
     KGFTESFKAP ELGVGNLGAS EKSDVFLVVS TLLHCIEGFE KNPEIKPNQG LRFITSEPAH       360
     VMDENGYPIH RPGIAGVETA YTRFITDILG VSADSRPDSN EARLHEFLSD GTIDEESAKQ       420
     ILKDTLTGEM SPLSTDVRRI TPKKLRELSD LLRTHLSSAA TKQLDMGGVL SDLDTMLVAL       480
     DKAEREGGVD KDQLKSFNSL ILKTYRVIED YVKGREGDTK NSSTEVSPYH RSNFMLSIVE       540
     PSLQRIQKHL DQTHSFSDIG SLVRAHKHLE TLLEVLVTLS QQGQPVSSET YGFLNRLAEA       600
     KITLSQQLNT LQQQQESAKA QLSILINRSG SWADVARQSL QRFDSTRPVV KFGTEQYTAI       660
     HRQMMAAHAA ITLQEVSEFT DDMRNFTVDS IPLLIQLGRS SLMDEHLVEQ REKLRELTTI       720
     AERLNRLERE WM                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page