(data stored in ACNUC9435 zone)

EMBL: BX936399.PE10

BX936399.PE10        Location/Qualifiers
FT   CDS             complement(7978..8436)
FT                   /transl_table=11
FT                   /locus_tag="pYV0010"
FT                   /product="hypothetical protein"
FT                   /note="similar to Y. pestis YPCD1.84c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25353"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q663F7"
FT                   /protein_id="CAF25353.1"
FT                   /translation="MGGMAAHWFTYQYAVPFCGRAKTLVTLSNAEGESVLISPQQNTAQ
FT                   DISLFMPRELTVSQGDRVRFTRSDTDRGYVANSLWEVAGFTEDGAVRFRQGDQEKIVDP
FT                   QKATEDRHIDLAYTLTAYGVQGASERFVIALFGAEGGRKRMATLHLFT"
     MGGMAAHWFT YQYAVPFCGR AKTLVTLSNA EGESVLISPQ QNTAQDISLF MPRELTVSQG        60
     DRVRFTRSDT DRGYVANSLW EVAGFTEDGA VRFRQGDQEK IVDPQKATED RHIDLAYTLT       120
     AYGVQGASER FVIALFGAEG GRKRMATLHL FT                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page