(data stored in ACNUC9435 zone)

EMBL: BX936399.PE12

BX936399.PE12        Location/Qualifiers
FT   CDS             complement(8771..8980)
FT                   /transl_table=11
FT                   /locus_tag="pYV0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25355"
FT                   /db_xref="UniProtKB/TrEMBL:Q663F5"
FT                   /protein_id="CAF25355.1"
FT                   /translation="MGNYMVSDEINRRNNLSDICYGHPIYVGCACINPNYINPQIQRSR
FT                   VNTARYFEQAAQFDHWPFCFQPCD"
     MGNYMVSDEI NRRNNLSDIC YGHPIYVGCA CINPNYINPQ IQRSRVNTAR YFEQAAQFDH        60
     WPFCFQPCD                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page