(data stored in ACNUC9435 zone)

EMBL: BX936399.PE13

BX936399.PE13        Location/Qualifiers
FT   CDS             complement(9103..10401)
FT                   /transl_table=11
FT                   /locus_tag="pYV0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25356"
FT                   /db_xref="GOA:P10858"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008126"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/Swiss-Prot:P10858"
FT                   /protein_id="CAF25356.1"
FT                   /translation="MTKDFKISVSAALISALFSSPYAFAEEPEDGNDGIPRLSAVQISP
FT                   NVDPKLGVGLYPAKPILRQENPKLPPRGPQGPEKKRARLAEAIQPQVLGGLDARAKGIH
FT                   SIAIGATAEAAKPAAVAVGAGSIATGVNSVAIGPLSKALGDSAVTYGASSTAQKDGVAI
FT                   GARASASDTGVAVGFNSKVDAQNSVAIGHSSHVAADHGYSIAIGDLSKTDRENSVSIGH
FT                   ESLNRQLTHLAAGTKDNDAVNVAQLKKEMAETLENARKETLAQSNDVLDAAKKHSNSVA
FT                   RTTLETAEEHANKKSAEALVSAKVYADSNSSHTLKTANSYTDVTVSSSTKKAISESNQY
FT                   TDHKFSQLDNRLDKLDKRVDKGLASSAALNSLFQPYGVGKVNFTAGVGGYRSSQALAIG
FT                   SGYRVNESVALKAGVAYAGSSNVMYNASFNIEW"
     MTKDFKISVS AALISALFSS PYAFAEEPED GNDGIPRLSA VQISPNVDPK LGVGLYPAKP        60
     ILRQENPKLP PRGPQGPEKK RARLAEAIQP QVLGGLDARA KGIHSIAIGA TAEAAKPAAV       120
     AVGAGSIATG VNSVAIGPLS KALGDSAVTY GASSTAQKDG VAIGARASAS DTGVAVGFNS       180
     KVDAQNSVAI GHSSHVAADH GYSIAIGDLS KTDRENSVSI GHESLNRQLT HLAAGTKDND       240
     AVNVAQLKKE MAETLENARK ETLAQSNDVL DAAKKHSNSV ARTTLETAEE HANKKSAEAL       300
     VSAKVYADSN SSHTLKTANS YTDVTVSSST KKAISESNQY TDHKFSQLDN RLDKLDKRVD       360
     KGLASSAALN SLFQPYGVGK VNFTAGVGGY RSSQALAIGS GYRVNESVAL KAGVAYAGSS       420
     NVMYNASFNI EW                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page