(data stored in ACNUC9435 zone)

EMBL: BX936399.PE16

BX936399.PE16        Location/Qualifiers
FT   CDS             complement(11386..13701)
FT                   /transl_table=11
FT                   /locus_tag="pYV0016"
FT                   /product="tnpA; putative transposase protein"
FT                   /note="similar to Y. pestis YPCD1.90c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25359"
FT                   /db_xref="GOA:Q663P8"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:Q663P8"
FT                   /protein_id="CAF25359.1"
FT                   /translation="MPVDFLTTEQEQNYGCYVAEPNDVQLVRYFHLDERDLAFIYQRRG
FT                   KHNRLGIALQLTTARFLGTFITDLTQVLPGVQHFVAVQLNIRRPEVLSRYAERDTTRRE
FT                   HTAQIKEYYGYHEFGDFPWSFRLKRLLYTRAWLSNERPGLMFDFATAWLLQNKILLPGA
FT                   TTLVRLVSEIRERANQRLWKKLAAIHYLTELNGTKKRLLDDAPEHIITGPWKRLVYDAE
FT                   GRIQRAGYSLCLLERLQDALRRRDIWLKNSDRWGDLREKLLQGEEWQAQRVLVCRALGH
FT                   PTDGHKGVQQLAVQLDETWRAVASRFEGNTEVHICNDGKYPSLTISSLEKLEEPLSLLR
FT                   LNNRVRQLLPPVDLTELLLEIDARTGFTREFTHVSESGARAQDLHISLCAVLMAEACNI
FT                   GLEPLIKHNIPALTRHRLSWMKQNYLQAETLVSANARLVDFQSTLELARRWGGGEVASV
FT                   DGMRFVTPVKTVNSGPNRKYFGSGRGITWYNFVSDQYSGFHGIVVPGTLRDSIFVLEGL
FT                   LEQQTGLNPVEIMTDTAGTSDIIFGLFWLLGYQFSPRLADAGEAVFWRVDKSANYGALD
FT                   ELARGCADLSKAENQWDEMMRTAGSLKLGTIHASELIRSLLKSSRPSGLAQAIMAVGRV
FT                   NKTLYLLNYIDDEDYRRRILTQLNRGESRHAVARAICYGQRGEIRKRYREGQEDQLGAL
FT                   GLVTNAVVLWNTLYMQEALSWMRSNGEETRDEDIARLSPLMHGHINMLGHYTFTLSDDI
FT                   LNGELRALNFNLNNELSP"
     MPVDFLTTEQ EQNYGCYVAE PNDVQLVRYF HLDERDLAFI YQRRGKHNRL GIALQLTTAR        60
     FLGTFITDLT QVLPGVQHFV AVQLNIRRPE VLSRYAERDT TRREHTAQIK EYYGYHEFGD       120
     FPWSFRLKRL LYTRAWLSNE RPGLMFDFAT AWLLQNKILL PGATTLVRLV SEIRERANQR       180
     LWKKLAAIHY LTELNGTKKR LLDDAPEHII TGPWKRLVYD AEGRIQRAGY SLCLLERLQD       240
     ALRRRDIWLK NSDRWGDLRE KLLQGEEWQA QRVLVCRALG HPTDGHKGVQ QLAVQLDETW       300
     RAVASRFEGN TEVHICNDGK YPSLTISSLE KLEEPLSLLR LNNRVRQLLP PVDLTELLLE       360
     IDARTGFTRE FTHVSESGAR AQDLHISLCA VLMAEACNIG LEPLIKHNIP ALTRHRLSWM       420
     KQNYLQAETL VSANARLVDF QSTLELARRW GGGEVASVDG MRFVTPVKTV NSGPNRKYFG       480
     SGRGITWYNF VSDQYSGFHG IVVPGTLRDS IFVLEGLLEQ QTGLNPVEIM TDTAGTSDII       540
     FGLFWLLGYQ FSPRLADAGE AVFWRVDKSA NYGALDELAR GCADLSKAEN QWDEMMRTAG       600
     SLKLGTIHAS ELIRSLLKSS RPSGLAQAIM AVGRVNKTLY LLNYIDDEDY RRRILTQLNR       660
     GESRHAVARA ICYGQRGEIR KRYREGQEDQ LGALGLVTNA VVLWNTLYMQ EALSWMRSNG       720
     EETRDEDIAR LSPLMHGHIN MLGHYTFTLS DDILNGELRA LNFNLNNELS P                771
//

If you have problems or comments...

PBIL Back to PBIL home page