(data stored in ACNUC9435 zone)

EMBL: BX936399.PE2

BX936399.PE2         Location/Qualifiers
FT   CDS             complement(2218..2667)
FT                   /transl_table=11
FT                   /locus_tag="pYV0002"
FT                   /product="hypothetical protein"
FT                   /note="similar to Y. pestis YPCD1.73c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25345"
FT                   /db_xref="UniProtKB/TrEMBL:Q663G5"
FT                   /protein_id="CAF25345.1"
FT                   /translation="MINTTFTELLPKIASHFGLDKLSQDEYGLCELILNDRVVIMLRAD
FT                   EILNRLTLLGPILGFSGPEARSAASQLFFCYSINALNKDGPCFAWSEELGLIAFKHLSL
FT                   DELNVENVSKEIANFYDWLSLVSLPAETQQELPLHTQSTQSVKWG"
     MINTTFTELL PKIASHFGLD KLSQDEYGLC ELILNDRVVI MLRADEILNR LTLLGPILGF        60
     SGPEARSAAS QLFFCYSINA LNKDGPCFAW SEELGLIAFK HLSLDELNVE NVSKEIANFY       120
     DWLSLVSLPA ETQQELPLHT QSTQSVKWG                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page