(data stored in ACNUC9435 zone)

EMBL: BX936399.PE20

BX936399.PE20        Location/Qualifiers
FT   CDS             complement(16714..17139)
FT                   /transl_table=11
FT                   /locus_tag="pYV0020"
FT                   /product="sycH; putative yopH targeting protein"
FT                   /note="similar to Y. pestis YPCD1.95c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25363"
FT                   /db_xref="GOA:I3NIC8"
FT                   /db_xref="InterPro:IPR010261"
FT                   /db_xref="UniProtKB/TrEMBL:I3NIC8"
FT                   /protein_id="CAF25363.1"
FT                   /translation="MRTYSSLLEEFATELGLEEIETNELGHGAVTIDKIWVVHLAPINE
FT                   KELVAFMRAGILTGQSQLYDILRKNLFSPLSGVIRCALDKDDHWLLWSQLNINDTSGTQ
FT                   LASVLTSLVDKAVTLSCEPTMKKEEDDHRPSSSHLLV"
     MRTYSSLLEE FATELGLEEI ETNELGHGAV TIDKIWVVHL APINEKELVA FMRAGILTGQ        60
     SQLYDILRKN LFSPLSGVIR CALDKDDHWL LWSQLNINDT SGTQLASVLT SLVDKAVTLS       120
     CEPTMKKEED DHRPSSSHLL V                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page