(data stored in ACNUC9435 zone)

EMBL: BX936399.PE26

BX936399.PE26        Location/Qualifiers
FT   CDS             complement(21282..21581)
FT                   /transl_table=11
FT                   /locus_tag="pYV0026"
FT                   /product="hypothetical protein"
FT                   /note="similar to Y. pestis YPCD1.08c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25369"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR028344"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q663N8"
FT                   /protein_id="CAF25369.1"
FT                   /translation="MYKLSELADEDIYNIASYTIRHFGVTQAKLYHENLAKVFELLAKN
FT                   PELGAECNWICSDIRRFQYKKHGIYYITLSNDILISRVLHQSIDIDVQDFPEHE"
     MYKLSELADE DIYNIASYTI RHFGVTQAKL YHENLAKVFE LLAKNPELGA ECNWICSDIR        60
     RFQYKKHGIY YITLSNDILI SRVLHQSIDI DVQDFPEHE                               99
//

If you have problems or comments...

PBIL Back to PBIL home page