(data stored in ACNUC9435 zone)

EMBL: BX936399.PE27

BX936399.PE27        Location/Qualifiers
FT   CDS             complement(21574..21849)
FT                   /transl_table=11
FT                   /locus_tag="pYV0027"
FT                   /product="hypothetical protein"
FT                   /note="similar to Y. pestis YPCD1.09c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25370"
FT                   /db_xref="GOA:Q663N7"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:Q663N7"
FT                   /protein_id="CAF25370.1"
FT                   /translation="MYYSVIHNGGDMAHVTSVTLGEHLTGFVGEMIQSGRYGNISEVLR
FT                   DALRLMEAREQRVQHVRDMVLAGTNVPVSHRLMDEIFSAAVKGTSV"
     MYYSVIHNGG DMAHVTSVTL GEHLTGFVGE MIQSGRYGNI SEVLRDALRL MEAREQRVQH        60
     VRDMVLAGTN VPVSHRLMDE IFSAAVKGTS V                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page