(data stored in ACNUC9435 zone)

EMBL: BX936399.PE30

BX936399.PE30        Location/Qualifiers
FT   CDS             complement(22682..22975)
FT                   /transl_table=11
FT                   /locus_tag="pYV0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25373"
FT                   /db_xref="UniProtKB/TrEMBL:Q663N4"
FT                   /protein_id="CAF25373.1"
FT                   /translation="MDIQVGPWSQLLTLALDIQVGPWSQLPTLALDIQVGPWSQLLTLA
FT                   LDIQVGPWSQLPTLTLDIQVGPWSQLPTLALDIQVGPWSQLLTLALNILVEM"
     MDIQVGPWSQ LLTLALDIQV GPWSQLPTLA LDIQVGPWSQ LLTLALDIQV GPWSQLPTLT        60
     LDIQVGPWSQ LPTLALDIQV GPWSQLLTLA LNILVEM                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page