(data stored in ACNUC9435 zone)

EMBL: BX936399.PE31

BX936399.PE31        Location/Qualifiers
FT   CDS             complement(23123..24088)
FT                   /transl_table=11
FT                   /locus_tag="pYV0031"
FT                   /product="sopB; putative plasmid partitioning control
FT                   protein"
FT                   /note="similar to Y. pestis YPCD1.12c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25374"
FT                   /db_xref="GOA:Q663N3"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR040873"
FT                   /db_xref="UniProtKB/TrEMBL:Q663N3"
FT                   /protein_id="CAF25374.1"
FT                   /translation="MMKRSPVLRNAPSINFDDAKPAISNAEPSVSAPAVSQLASRVSGM
FT                   KGNTIVLPVCGRNVAFTLKVIAAPDVESKTIVFSGNERNQALLSETSLDDLIPSFLTSG
FT                   QQIPAFAREHNGNIEVADGSRRRKAAILTGSDYKVLVGNLNDEQMLWLSQIANEYRPTS
FT                   AYERGLRYAQRLISEFEGNISKLAEAEHLSRKIIQRCIKTAGLPLKTIQLFANPNELSA
FT                   RSGEALSKAYENNVDTLKRVTYKIMKQKQEGRQFTTEELIVLLMPERKQPENIHKKSFG
FT                   KNIEAKYSKDNVSFYLKSVPESLVKQIEELLNTYAKEHSL"
     MMKRSPVLRN APSINFDDAK PAISNAEPSV SAPAVSQLAS RVSGMKGNTI VLPVCGRNVA        60
     FTLKVIAAPD VESKTIVFSG NERNQALLSE TSLDDLIPSF LTSGQQIPAF AREHNGNIEV       120
     ADGSRRRKAA ILTGSDYKVL VGNLNDEQML WLSQIANEYR PTSAYERGLR YAQRLISEFE       180
     GNISKLAEAE HLSRKIIQRC IKTAGLPLKT IQLFANPNEL SARSGEALSK AYENNVDTLK       240
     RVTYKIMKQK QEGRQFTTEE LIVLLMPERK QPENIHKKSF GKNIEAKYSK DNVSFYLKSV       300
     PESLVKQIEE LLNTYAKEHS L                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page