(data stored in ACNUC9435 zone)

EMBL: BX936399.PE35

BX936399.PE35        Location/Qualifiers
FT   CDS             complement(26357..26815)
FT                   /transl_table=11
FT                   /locus_tag="pYV0035"
FT                   /product="hypothetical protein"
FT                   /note="similar to Y. pestis YPCD1.15c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25378"
FT                   /db_xref="GOA:Q663M9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q663M9"
FT                   /protein_id="CAF25378.1"
FT                   /translation="MVELCRLLKITRSVYSASLNLRVDVKRLQLRELHQQSRGAAGNRT
FT                   LSLLMRQSGYNVGRWLAGRLMRECGLASRQPGKPRYRGEREVSLASPDLLKRQFKPSEP
FT                   NRVWSGYISYIKVNGGWCYLALVIDLYSRRIVGSAISSSPDAELVCRA"
     MVELCRLLKI TRSVYSASLN LRVDVKRLQL RELHQQSRGA AGNRTLSLLM RQSGYNVGRW        60
     LAGRLMRECG LASRQPGKPR YRGEREVSLA SPDLLKRQFK PSEPNRVWSG YISYIKVNGG       120
     WCYLALVIDL YSRRIVGSAI SSSPDAELVC RA                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page