(data stored in ACNUC9435 zone)

EMBL: BX936399.PE40

BX936399.PE40        Location/Qualifiers
FT   CDS             complement(28491..29039)
FT                   /transl_table=11
FT                   /locus_tag="pYV0040"
FT                   /product="yop targeting protein yopK, yopQ"
FT                   /note="similar to Y. pestis YPCD1.19c, yopK, yopQ, probable
FT                   virulence determinant protein"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25383"
FT                   /db_xref="InterPro:IPR016505"
FT                   /db_xref="UniProtKB/TrEMBL:I3NI99"
FT                   /protein_id="CAF25383.1"
FT                   /translation="MFIKDTYNMRALCTALEQSAPDTIINTSKEENNSYYCATAHLLRT
FT                   DVCSLVNRVGIEPLKSGSILSTLEELWQAVGIVYRLYEWQHVSDIDTNFKKLPNNSDFG
FT                   LVFSVLDCDIEYVFIGKKDSEGNIEFYDPKNSLLIENDDIKKYLYDENFHRFCIMLIIS
FT                   KSELEELSRESCDQECIMG"
     MFIKDTYNMR ALCTALEQSA PDTIINTSKE ENNSYYCATA HLLRTDVCSL VNRVGIEPLK        60
     SGSILSTLEE LWQAVGIVYR LYEWQHVSDI DTNFKKLPNN SDFGLVFSVL DCDIEYVFIG       120
     KKDSEGNIEF YDPKNSLLIE NDDIKKYLYD ENFHRFCIML IISKSELEEL SRESCDQECI       180
     MG                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page