(data stored in ACNUC9435 zone)

EMBL: BX936399.PE44

BX936399.PE44        Location/Qualifiers
FT   CDS             31576..31995
FT                   /transl_table=11
FT                   /locus_tag="pYV0044"
FT                   /product="hypothetical protein"
FT                   /note="similar to Y. pestis YPCD1.23"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25387"
FT                   /db_xref="UniProtKB/TrEMBL:Q663M2"
FT                   /protein_id="CAF25387.1"
FT                   /translation="MSKIPTLIICSKPAEIAVGHFITMSIKAILLYSYQEYGQHTDVFI
FT                   QVKFNYGMIEYKFYVNKVKFDNTPGRKLKTTIAHSSQLMGHNLTYEDYAMKKRLVIATA
FT                   LCAAFYAGMKVEHFLTVDACLDAGGAMQNDIFCER"
     MSKIPTLIIC SKPAEIAVGH FITMSIKAIL LYSYQEYGQH TDVFIQVKFN YGMIEYKFYV        60
     NKVKFDNTPG RKLKTTIAHS SQLMGHNLTY EDYAMKKRLV IATALCAAFY AGMKVEHFLT       120
     VDACLDAGGA MQNDIFCER                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page