(data stored in ACNUC9435 zone)

EMBL: BX936399.PE47

BX936399.PE47        Location/Qualifiers
FT   CDS             complement(33232..34884)
FT                   /transl_table=11
FT                   /locus_tag="pYV0047"
FT                   /product="yopM; putative targeted effector protein"
FT                   /note="similar to Y. pestis YPCD1.26c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25390"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR032674"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q663L9"
FT                   /protein_id="CAF25390.1"
FT                   /translation="MYGFVCSEKLDNKNIFRKAFNMFINPRNVSNTFLQEPLRHSSNLT
FT                   EMPVEAENVKSKTEYYNAWSEWERNAPPGNGEQREMAVSRLRDCLDRQAHELELNNLGL
FT                   SSLPELPPHLESLVASCNSLTELPELPQSLKSLQVENNNLKALPDLPPSLKKLHVREND
FT                   LTDLPELPQSLESLRVDNNNLKALSDLPPSLEYLTASSNKLEELPELQNLPFLAAIYAD
FT                   NNLLETLPDLPPSLKKLHVRENDLTDLPELPQSLESLRVDNNNLKALSDLPPSLEYLTA
FT                   SSNKLEELPELQNLPFLAAIYADNNLLETLPDLPPHLEILVASYNSLTELPELPQSLKS
FT                   LRVDNNNLKALSDLPPSLEYLTASSNKLEELPELQNLPFLAAIYADNNLLETLPDLPPS
FT                   LKKLHVRENDLTDLPELPQSLTFLDVSDNNISGLSELPPNLYYLDASSNEIRSLCDLPP
FT                   SLVDLNVKSNQLSELPALPPHLERLIASFNYLAEVPELPQNLKQLHVEQNALREFPDIP
FT                   ESLEELEMDSERVVDPYEFAHETTDKLEDDVFE"
     MYGFVCSEKL DNKNIFRKAF NMFINPRNVS NTFLQEPLRH SSNLTEMPVE AENVKSKTEY        60
     YNAWSEWERN APPGNGEQRE MAVSRLRDCL DRQAHELELN NLGLSSLPEL PPHLESLVAS       120
     CNSLTELPEL PQSLKSLQVE NNNLKALPDL PPSLKKLHVR ENDLTDLPEL PQSLESLRVD       180
     NNNLKALSDL PPSLEYLTAS SNKLEELPEL QNLPFLAAIY ADNNLLETLP DLPPSLKKLH       240
     VRENDLTDLP ELPQSLESLR VDNNNLKALS DLPPSLEYLT ASSNKLEELP ELQNLPFLAA       300
     IYADNNLLET LPDLPPHLEI LVASYNSLTE LPELPQSLKS LRVDNNNLKA LSDLPPSLEY       360
     LTASSNKLEE LPELQNLPFL AAIYADNNLL ETLPDLPPSL KKLHVRENDL TDLPELPQSL       420
     TFLDVSDNNI SGLSELPPNL YYLDASSNEI RSLCDLPPSL VDLNVKSNQL SELPALPPHL       480
     ERLIASFNYL AEVPELPQNL KQLHVEQNAL REFPDIPESL EELEMDSERV VDPYEFAHET       540
     TDKLEDDVFE                                                              550
//

If you have problems or comments...

PBIL Back to PBIL home page