(data stored in ACNUC9435 zone)

EMBL: BX936399.PE5

BX936399.PE5         Location/Qualifiers
FT   CDS             complement(4823..5701)
FT                   /transl_table=11
FT                   /locus_tag="pYV0005"
FT                   /product="repA, repA1; putative replication initiation
FT                   protein"
FT                   /note="similar to Y. pestis YPCD1.77c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25348"
FT                   /db_xref="GOA:Q663G2"
FT                   /db_xref="InterPro:IPR003446"
FT                   /db_xref="InterPro:IPR017837"
FT                   /db_xref="UniProtKB/TrEMBL:Q663G2"
FT                   /protein_id="CAF25348.1"
FT                   /translation="MREGVTNHQALFTHHYRQVKNPNPEFTPREGKKTLPFCRKLMAKA
FT                   EGFTSRFDFSMHVAFARSLSLRHRMPPLLRRRAIDALLQGMCFHYDPLANRIQRSITNL
FT                   AIECGLATESKSGNLSITRATRALRFLSELGLITYQTEYDPQIGCNIPTDITFTPALFS
FT                   ALDVSDVAVAAARRSRVEWENQQREKQRLPRLEMDELIAKAWRFVRERFRSYQTERKAH
FT                   GLKRARARRDVDRTRRDIEAIVNRQLTREIAEGRFVGNLDAVRREKARRVKERMLMSRN
FT                   NNYTRLATGAT"
     MREGVTNHQA LFTHHYRQVK NPNPEFTPRE GKKTLPFCRK LMAKAEGFTS RFDFSMHVAF        60
     ARSLSLRHRM PPLLRRRAID ALLQGMCFHY DPLANRIQRS ITNLAIECGL ATESKSGNLS       120
     ITRATRALRF LSELGLITYQ TEYDPQIGCN IPTDITFTPA LFSALDVSDV AVAAARRSRV       180
     EWENQQREKQ RLPRLEMDEL IAKAWRFVRE RFRSYQTERK AHGLKRARAR RDVDRTRRDI       240
     EAIVNRQLTR EIAEGRFVGN LDAVRREKAR RVKERMLMSR NNNYTRLATG AT               292
//

If you have problems or comments...

PBIL Back to PBIL home page