(data stored in ACNUC9435 zone)

EMBL: BX936399.PE50

BX936399.PE50        Location/Qualifiers
FT   CDS             35445..35567
FT                   /transl_table=11
FT                   /locus_tag="pYV0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25393"
FT                   /db_xref="UniProtKB/TrEMBL:Q663L6"
FT                   /protein_id="CAF25393.1"
FT                   /translation="MAPGDFKWEHFAPDELCQCQRYAVRAWDFRLSLYHLPLVY"
     MAPGDFKWEH FAPDELCQCQ RYAVRAWDFR LSLYHLPLVY                              40
//

If you have problems or comments...

PBIL Back to PBIL home page