(data stored in ACNUC9435 zone)

EMBL: BX936399.PE55

BX936399.PE55        Location/Qualifiers
FT   CDS             complement(37490..38695)
FT                   /transl_table=11
FT                   /locus_tag="pYV0055"
FT                   /product="yopB; putative Yop targeting protein"
FT                   /note="similar to Y. pestis YPCD1.29c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25398"
FT                   /db_xref="GOA:Q06114"
FT                   /db_xref="InterPro:IPR006972"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06114"
FT                   /protein_id="CAF25398.1"
FT                   /translation="MSALITHDRSTPVTGSLLPYVETPAPAPLQTQQVAGELKDKNGGV
FT                   SSQGVQLPAPLAVVASQVTEGQQQEVTKLLESVTRGAAGSQLISNYVSVLTKFTLASPD
FT                   TFEIELGKLVSNLEEVRKDIKIADIQRLHEQNMKKIEENQEKIKETEENAKQVKKSGIA
FT                   SKIFGWLSAIASVIVGAIMVASGVGAVAGAMMVASGVIGMANMAVKQAAEDGLISQEAM
FT                   KILGPILTAIEVALTVVSTVMTFGGSALKCLANIGAKLGANTASLAAKGAEFSAKVAQI
FT                   STGISNTVGSAVTKLGGSFAGLTMSHAIRTGSQATQVAVGVGSGITQTINNKKQADLQH
FT                   NNADLALNKADMAALQSIIDRLKEELSHLSESHQQVMELIFQMINAKGDMLHNLAGRPH
FT                   TV"
     MSALITHDRS TPVTGSLLPY VETPAPAPLQ TQQVAGELKD KNGGVSSQGV QLPAPLAVVA        60
     SQVTEGQQQE VTKLLESVTR GAAGSQLISN YVSVLTKFTL ASPDTFEIEL GKLVSNLEEV       120
     RKDIKIADIQ RLHEQNMKKI EENQEKIKET EENAKQVKKS GIASKIFGWL SAIASVIVGA       180
     IMVASGVGAV AGAMMVASGV IGMANMAVKQ AAEDGLISQE AMKILGPILT AIEVALTVVS       240
     TVMTFGGSAL KCLANIGAKL GANTASLAAK GAEFSAKVAQ ISTGISNTVG SAVTKLGGSF       300
     AGLTMSHAIR TGSQATQVAV GVGSGITQTI NNKKQADLQH NNADLALNKA DMAALQSIID       360
     RLKEELSHLS ESHQQVMELI FQMINAKGDM LHNLAGRPHT V                           401
//

If you have problems or comments...

PBIL Back to PBIL home page