(data stored in ACNUC9435 zone)

EMBL: BX936399.PE56

BX936399.PE56        Location/Qualifiers
FT   CDS             complement(38673..39179)
FT                   /transl_table=11
FT                   /locus_tag="pYV0056"
FT                   /product="lcrH, sycD; low calcium response protein H"
FT                   /note="similar to Y. pestis YPCD1.30c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25399"
FT                   /db_xref="InterPro:IPR005415"
FT                   /db_xref="InterPro:IPR011716"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016379"
FT                   /db_xref="PDB:1OOL"
FT                   /db_xref="PDB:1OOS"
FT                   /db_xref="UniProtKB/Swiss-Prot:P23995"
FT                   /protein_id="CAF25399.1"
FT                   /translation="MQQETTDTQEYQLAMESFLKGGGTIAMLNEISSDTLEQLYSLAFN
FT                   QYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYSYGAIMDIKEP
FT                   RFPFHAAECLLQKGELAEAESGLFLAQELIADKPEFKELSTRVSSMLEAIKLKKEMEHE
FT                   CVDNP"
     MQQETTDTQE YQLAMESFLK GGGTIAMLNE ISSDTLEQLY SLAFNQYQSG KYEDAHKVFQ        60
     ALCVLDHYDS RFFLGLGACR QAMGQYDLAI HSYSYGAIMD IKEPRFPFHA AECLLQKGEL       120
     AEAESGLFLA QELIADKPEF KELSTRVSSM LEAIKLKKEM EHECVDNP                    168
//

If you have problems or comments...

PBIL Back to PBIL home page