(data stored in ACNUC9435 zone)

EMBL: BX936399.PE57

BX936399.PE57        Location/Qualifiers
FT   CDS             complement(39192..40172)
FT                   /transl_table=11
FT                   /locus_tag="pYV0057"
FT                   /product="lcrV; putative V antigen, antihost
FT                   protein/regulator"
FT                   /note="similar to Y. pestis YPCD1.31c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25400"
FT                   /db_xref="GOA:P23994"
FT                   /db_xref="InterPro:IPR005413"
FT                   /db_xref="InterPro:IPR036139"
FT                   /db_xref="UniProtKB/Swiss-Prot:P23994"
FT                   /protein_id="CAF25400.1"
FT                   /translation="MIRAYEQNPQHFIEDLEKVRVEQLTGHGSSVLEELVQLVKDKNID
FT                   ISIKYDPRKDSEVFANRVITDDIELLKKILAYFLPEDAILKGGHYDNQLQNGIKRVKEF
FT                   LESSPNTQWELRAFMAVIHFSLTADRIDDDILKVIVDSMNHHGDARSKLREELAELTAE
FT                   LKIYSVIQAEINKHLSSGGTINIHDKSINLMDKNLYGYTDEEIFKASAEYKILEKMPQT
FT                   TIQEGETEKKIVSIKNFLESEKKRTGALGNLKDSYSYNKDNNELSHFATTCSDKSRPLN
FT                   DLVSQKTTQLSDITSRFNSAIEALNRFIQKYDSVMQRLLDDTSGK"
     MIRAYEQNPQ HFIEDLEKVR VEQLTGHGSS VLEELVQLVK DKNIDISIKY DPRKDSEVFA        60
     NRVITDDIEL LKKILAYFLP EDAILKGGHY DNQLQNGIKR VKEFLESSPN TQWELRAFMA       120
     VIHFSLTADR IDDDILKVIV DSMNHHGDAR SKLREELAEL TAELKIYSVI QAEINKHLSS       180
     GGTINIHDKS INLMDKNLYG YTDEEIFKAS AEYKILEKMP QTTIQEGETE KKIVSIKNFL       240
     ESEKKRTGAL GNLKDSYSYN KDNNELSHFA TTCSDKSRPL NDLVSQKTTQ LSDITSRFNS       300
     AIEALNRFIQ KYDSVMQRLL DDTSGK                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page